Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries) |
Domain d5zqjb2: 5zqj B:324-533 [353149] Other proteins in same PDB: d5zqja1, d5zqjb1 automated match to d3c2ub2 complexed with gol |
PDB Entry: 5zqj (more details), 1.73 Å
SCOPe Domain Sequences for d5zqjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zqjb2 b.29.1.0 (B:324-533) automated matches {Bacillus pumilus [TaxId: 1408]} sptyhivdefkdsslnrhfqtlripftdqigsvtenphhlrlygqesltskftqafvarr wqsfyfeaetavsffpknfqqaaglvnyyntenwtalqvtyddalgrilelsvcenlafs qplikkiiipdeipyvylkvtvqretytysysfdqqewekidvplesthlsddfirgggf ftgafvgmqcqdtsgerlpadfkyfryeet
Timeline for d5zqjb2: