SCOPe 2.07: Domain d5vz6a2: 5vz6 A:430-557

Lineage for d5vz6a2 (5vz6 A:430-557)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [353118] (4 PDB entries)

8. Domain d5vz6a2: 5vz6 A:430-557 [353119]
   Other proteins in same PDB: d5vz6a1, d5vz6a3, d5vz6b_
   automated match to d1bqna1
   complexed with 9tv

Details for d5vz6a2

PDB Entry: 5vz6, 2.6 Å

PDB Description: hiv reverse transcriptase complexed with (e)-3-(pyrimidin-2-yl)-n-(5- (5,6,7,8-tetrahydronaphthalen-2-yl)-1h-pyrazol-3-yl)acrylamide

PDB Compounds: (A:) HIV Reverse transcriptase

SCOPe Domain Sequences for d5vz6a2:

Sequence; same for both SEQRES and ATOM records:

>d5vz6a2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

Timeline for d5vz6a2:

• d5vz6a2 is new in SCOPe 2.07-stable
  
• d5vz6a2 appears in the current release, SCOPe 2.08