Class a: All alpha proteins [46456] (289 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
Protein automated matches [190621] (30 species) not a true protein |
Species Homo sapiens [TaxId:63221] [352880] (3 PDB entries) |
Domain d5nx9b_: 5nx9 B: [352990] automated match to d2j91b_ complexed with 2sa, amp, cl, fum, gol, peg |
PDB Entry: 5nx9 (more details), 2.3 Å
SCOPe Domain Sequences for d5nx9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nx9b_ a.127.1.0 (B:) automated matches {Homo sapiens [TaxId: 63221]} gspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemks nlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrna ldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlk rvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkv dievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserccsl arhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypk vierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieri qadayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkaelc
Timeline for d5nx9b_: