Lineage for d5nqdh_ (5nqd H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2392187Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2392188Protein automated matches [190701] (13 species)
    not a true protein
  7. 2392328Species Rhizobium sp. [TaxId:1125847] [352895] (1 PDB entry)
  8. 2392332Domain d5nqdh_: 5nqd H: [352937]
    automated match to d4aayb_
    complexed with 4mo, edo, f3s, fes, gol, mgd, o, p33, peg, pge, so4; mutant

Details for d5nqdh_

PDB Entry: 5nqd (more details), 2.2 Å

PDB Description: arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a
PDB Compounds: (H:) Arsenite oxidase small subunit AioB Rieske [2Fe-2S] cluster

SCOPe Domain Sequences for d5nqdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqdh_ b.33.1.0 (H:) automated matches {Rhizobium sp. [TaxId: 1125847]}
aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
phkgaplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
deliygrlsnvl

SCOPe Domain Coordinates for d5nqdh_:

Click to download the PDB-style file with coordinates for d5nqdh_.
(The format of our PDB-style files is described here.)

Timeline for d5nqdh_: