Lineage for d5nvob_ (5nvo B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394316Protein automated matches [190966] (1 species)
    not a true protein
  7. 2394317Species Human (Homo sapiens) [TaxId:9606] [188600] (18 PDB entries)
  8. 2394344Domain d5nvob_: 5nvo B: [352875]
    automated match to d3qkjb_
    complexed with cht, so4

Details for d5nvob_

PDB Entry: 5nvo (more details), 2.4 Å

PDB Description: human dnmt3b pwwp domain in complex with choline
PDB Compounds: (B:) DNA (cytosine-5)-methyltransferase 3B

SCOPe Domain Sequences for d5nvob_:

Sequence, based on SEQRES records: (download)

>d5nvob_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmlew
ahggfkptgieglkp

Sequence, based on observed residues (ATOM records): (download)

>d5nvob_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpedqlkpmlewahggfkp
tgieglkp

SCOPe Domain Coordinates for d5nvob_:

Click to download the PDB-style file with coordinates for d5nvob_.
(The format of our PDB-style files is described here.)

Timeline for d5nvob_: