Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Tepidiphilus thermophilus [TaxId:876478] [352859] (2 PDB entries) |
Domain d6giia_: 6gii A: [352860] automated match to d1q5ea_ complexed with hem |
PDB Entry: 6gii (more details), 1.9 Å
SCOPe Domain Sequences for d6giia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6giia_ a.104.1.0 (A:) automated matches {Tepidiphilus thermophilus [TaxId: 876478]} vhrlaedfdpfqdaymadpaqfvrwareqvpifyapklnywvvtrydtikqifrdpvtfs psnvlqsfaqpsaevrqvlerygyafnrtlvnedepmhlerrrvlmepfasehlaehepm vrelvrravnrfidtgradlvdqmiwevpftvalhflgvddddrekmrrfaiahtvnafg rpspeeqlavaetvgqfwqfcgevlekmrrtadgpgwmrysirqqklypdvvtdsylhsm mqaiivaahettvfattnalktllehetvwreicadpslipaaaeeclryngpvagwrrr ttrevevegvrlpvganilmvvasanhdsahfddpeffdigrsnasehlnfgygahqclg rnlgrmemqimieelsrrlphmrlaeqrfdylhnvsfraprhlwvewdpaqnperr
Timeline for d6giia_: