![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins) |
![]() | Protein Tryptophan synthase, beta-subunit [53688] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [53689] (27 PDB entries) |
![]() | Domain d1cx9b_: 1cx9 B: [35284] Other proteins in same PDB: d1cx9a_ |
PDB Entry: 1cx9 (more details), 2.3 Å
SCOP Domain Sequences for d1cx9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx9b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium} tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm reqpekeqllvvnlsgrgdkdiftvhd
Timeline for d1cx9b_: