Lineage for d1cx9b_ (1cx9 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185419Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 185420Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 185421Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 185467Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 185468Species Salmonella typhimurium [TaxId:90371] [53689] (27 PDB entries)
  8. 185489Domain d1cx9b_: 1cx9 B: [35284]
    Other proteins in same PDB: d1cx9a_

Details for d1cx9b_

PDB Entry: 1cx9 (more details), 2.3 Å

PDB Description: crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-aminophenylthio)-butylphosphonic acid

SCOP Domain Sequences for d1cx9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx9b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhd

SCOP Domain Coordinates for d1cx9b_:

Click to download the PDB-style file with coordinates for d1cx9b_.
(The format of our PDB-style files is described here.)

Timeline for d1cx9b_: