SCOP 1.61: Domain d1c8vb_: 1c8v B:

Lineage for d1c8vb_ (1c8v B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (27 PDB entries)

8. Domain d1c8vb_: 1c8v B: [35282]
   Other proteins in same PDB: d1c8va_

Details for d1c8vb_

PDB Entry: 1c8v, 2.2 Å

PDB Description: crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylthio)-butylphosphonic acid

SCOP Domain Sequences for d1c8vb_:

Sequence; same for both SEQRES and ATOM records:

>d1c8vb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhd

Timeline for d1c8vb_:

• d1c8vb_ first appeared (with stable ids) in SCOP 1.55
  
• d1c8vb_ appears in SCOP 1.59
  
• d1c8vb_ appears in SCOP 1.63
  
• d1c8vb_ appears in the current release, SCOPe 2.08