SCOPe 2.07: Domain d1a50b_: 1a50 B:

Lineage for d1a50b_ (1a50 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (56 PDB entries)

8. Domain d1a50b_: 1a50 B: [35280]
   Other proteins in same PDB: d1a50a_
   complexed with fip, na, plp

Details for d1a50b_

PDB Entry: 1a50, 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate

PDB Compounds: (B:) tryptophan synthase (beta chain)

SCOPe Domain Sequences for d1a50b_:

Sequence; same for both SEQRES and ATOM records:

>d1a50b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d1a50b_:

• d1a50b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a50b_ appears in SCOPe 2.06
  
• d1a50b_ appears in the current release, SCOPe 2.08