SCOP 1.61: Domain d2trsb_: 2trs B:

Lineage for d2trsb_ (2trs B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (27 PDB entries)

8. Domain d2trsb_: 2trs B: [35277]
   Other proteins in same PDB: d2trsa_

Details for d2trsb_

PDB Entry: 2trs, 2.04 Å

PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes

SCOP Domain Sequences for d2trsb_:

Sequence; same for both SEQRES and ATOM records:

>d2trsb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d2trsb_:

• d2trsb_ first appeared (with stable ids) in SCOP 1.55
  
• d2trsb_ appears in SCOP 1.59
  
• d2trsb_ appears in SCOP 1.63
  
• d2trsb_ appears in the current release, SCOPe 2.08