![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudodyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins) |
![]() | Protein Tryptophan synthase, beta-subunit [53688] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [53689] (31 PDB entries) |
![]() | Domain d1beub_: 1beu B: [35274] Other proteins in same PDB: d1beua_ complexed with ipl, k, pls; mutant |
PDB Entry: 1beu (more details), 1.9 Å
SCOP Domain Sequences for d1beub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beub_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium} tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm reqpekeqllvvnlsgrgdkdiftvhdil
Timeline for d1beub_: