Lineage for d1beub_ (1beu B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249795Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudodyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 249796Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 249797Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 249843Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 249844Species Salmonella typhimurium [TaxId:90371] [53689] (31 PDB entries)
  8. 249858Domain d1beub_: 1beu B: [35274]
    Other proteins in same PDB: d1beua_
    complexed with ipl, k, pls; mutant

Details for d1beub_

PDB Entry: 1beu (more details), 1.9 Å

PDB Description: trp synthase (d60n-ipp-ser) with k+

SCOP Domain Sequences for d1beub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beub_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

SCOP Domain Coordinates for d1beub_:

Click to download the PDB-style file with coordinates for d1beub_.
(The format of our PDB-style files is described here.)

Timeline for d1beub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1beua_