SCOP 1.63: Domain d1ttpb_: 1ttp B:

Lineage for d1ttpb_ (1ttp B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (31 PDB entries)

8. Domain d1ttpb_: 1ttp B: [35269]
   Other proteins in same PDB: d1ttpa_
   complexed with cs, plp

Details for d1ttpb_

PDB Entry: 1ttp, 2.3 Å

PDB Description: tryptophan synthase (e.c.4.2.1.20) in the presence of cesium, room temperature

SCOP Domain Sequences for d1ttpb_:

Sequence; same for both SEQRES and ATOM records:

>d1ttpb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d1ttpb_:

• d1ttpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ttpb_ appears in SCOP 1.61
  
• d1ttpb_ appears in SCOP 1.65
  
• d1ttpb_ appears in the current release, SCOPe 2.08