Lineage for d5oxda2 (5oxd A:179-495)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418664Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 protein domains)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2418715Protein automated matches [254553] (2 species)
    not a true protein
  7. 2418722Species Clostridium perfringens [TaxId:1502] [255690] (2 PDB entries)
  8. 3052125Domain d5oxda2: 5oxd A:179-495 [352187]
    Other proteins in same PDB: d5oxda1, d5oxda3
    automated match to d2v5ca2
    complexed with b2w, cd

Details for d5oxda2

PDB Entry: 5oxd (more details), 2.6 Å

PDB Description: complex of a c. perfringens o-glcnacase with a fragment hit
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d5oxda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxda2 c.1.8.10 (A:179-495) automated matches {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d5oxda2:

Click to download the PDB-style file with coordinates for d5oxda2.
(The format of our PDB-style files is described here.)

Timeline for d5oxda2:

  • d5oxda2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17