Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
Protein automated matches [227062] (5 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries) |
Domain d5oxda1: 5oxd A:39-178 [352186] Other proteins in same PDB: d5oxda2, d5oxda3 automated match to d2v5ca1 complexed with b2w, cd |
PDB Entry: 5oxd (more details), 2.6 Å
SCOPe Domain Sequences for d5oxda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oxda1 d.92.2.0 (A:39-178) automated matches {Clostridium perfringens [TaxId: 1502]} nqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsend pnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqt fkqlvkesnipevnitdypt
Timeline for d5oxda1: