Lineage for d5oxda1 (5oxd A:39-178)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2530337Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2530439Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2530440Protein automated matches [227062] (4 species)
    not a true protein
  7. 2530447Species Clostridium perfringens [TaxId:1502] [255689] (2 PDB entries)
  8. 3052124Domain d5oxda1: 5oxd A:39-178 [352186]
    Other proteins in same PDB: d5oxda2, d5oxda3
    automated match to d2v5ca1
    complexed with b2w, cd

Details for d5oxda1

PDB Entry: 5oxd (more details), 2.6 Å

PDB Description: complex of a c. perfringens o-glcnacase with a fragment hit
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d5oxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxda1 d.92.2.0 (A:39-178) automated matches {Clostridium perfringens [TaxId: 1502]}
nqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsend
pnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqt
fkqlvkesnipevnitdypt

SCOPe Domain Coordinates for d5oxda1:

Click to download the PDB-style file with coordinates for d5oxda1.
(The format of our PDB-style files is described here.)

Timeline for d5oxda1:

  • d5oxda1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17