Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species Human coronavirus [TaxId:443239] [188597] (6 PDB entries) |
Domain d5nh0a_: 5nh0 A: [352154] automated match to d3tloa_ complexed with 8x8, dms, gol |
PDB Entry: 5nh0 (more details), 2.35 Å
SCOPe Domain Sequences for d5nh0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nh0a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]} sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt svssvecysilaaktgvsveqllasiqhlhegfggknilgyaslcdeftlaevvkqmyg
Timeline for d5nh0a_: