Lineage for d6am8a_ (6am8 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2515084Protein automated matches [190054] (15 species)
    not a true protein
  7. 2515113Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. 2515146Domain d6am8a_: 6am8 A: [352100]
    automated match to d1v8zb_
    complexed with na, plt, trp

Details for d6am8a_

PDB Entry: 6am8 (more details), 1.83 Å

PDB Description: engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2)
PDB Compounds: (A:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d6am8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6am8a_ c.79.1.1 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakvylkredlvhggahktnnaigqallaklmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlka

SCOPe Domain Coordinates for d6am8a_:

Click to download the PDB-style file with coordinates for d6am8a_.
(The format of our PDB-style files is described here.)

Timeline for d6am8a_: