SCOPe 2.07: Domain d5vtae2: 5vta E:108-207

Lineage for d5vtae2 (5vta E:108-207)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d5vtae2: 5vta E:108-207 [351980]
   Other proteins in same PDB: d5vtaa1, d5vtaa2, d5vtab1, d5vtab2, d5vtac1, d5vtac2, d5vtad1, d5vtad2, d5vtae1, d5vtag_, d5vtaj_, d5vtal1
   automated match to d1t3fa2
   complexed with 9k4, edo, nag, peg, pg4

Details for d5vtae2

PDB Entry: 5vta, 2.8 Å

PDB Description: co-crystal structure of dppiv with a chemibody inhibitor

PDB Compounds: (E:) Fab light chain

SCOPe Domain Sequences for d5vtae2:

Sequence, based on SEQRES records:

>d5vtae2 b.1.1.2 (E:108-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtks

Sequence, based on observed residues (ATOM records):

>d5vtae2 b.1.1.2 (E:108-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvlqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqglsspvtks

Timeline for d5vtae2:

• d5vtae2 is new in SCOPe 2.07-stable
  
• d5vtae2 appears in the current release, SCOPe 2.08