Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5yoyo_: 5yoy O: [351978] Other proteins in same PDB: d5yoya1, d5yoya2, d5yoyb1, d5yoyb2, d5yoyc1, d5yoyc2, d5yoyg_, d5yoyh_, d5yoyi_, d5yoyj1, d5yoyj2, d5yoyk1, d5yoyk2, d5yoyl1, d5yoyl2, d5yoyp_, d5yoyq_, d5yoyr_ automated match to d5lbsm_ |
PDB Entry: 5yoy (more details), 2.73 Å
SCOPe Domain Sequences for d5yoyo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yoyo_ b.1.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgeratlscrasqsvysylawyqqkpgqaprlliydasnratgipa rfsgsgsgtdftltisslepedfavyycqqrsnwppftfgpgtkvdik
Timeline for d5yoyo_: