Lineage for d6by2c1 (6by2 C:22-116)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 protein domains)
  6. 2577083Protein Potassium channel protein [56901] (3 species)
  7. 2577084Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 3051766Domain d6by2c1: 6by2 C:22-116 [351828]
    Other proteins in same PDB: d6by2b1, d6by2b2, d6by2c2
    automated match to d1r3jc_
    complexed with dga, f09, k; mutant

Details for d6by2c1

PDB Entry: 6by2 (more details), 2.35 Å

PDB Description: closed and deep-inactivated conformation of kcsa-t75a mutant
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d6by2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6by2c1 f.14.1.1 (C:22-116) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvg

SCOPe Domain Coordinates for d6by2c1:

Click to download the PDB-style file with coordinates for d6by2c1.
(The format of our PDB-style files is described here.)

Timeline for d6by2c1:

  • d6by2c1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-09

View in 3D
Domains from same chain:
(mouse over for more information)
d6by2c2