SCOPe 2.07: Domain d5mvjb1: 5mvj B:1-112

Lineage for d5mvjb1 (5mvj B:1-112)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d5mvjb1: 5mvj B:1-112 [351809]
Other proteins in same PDB: d5mvjb2, d5mvjd2, d5mvjf2, d5mvjl2
automated match to d3okla1
complexed with cl

Details for d5mvjb1

PDB Entry: 5mvj (more details), 2.5 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in space-group p1

PDB Compounds: (B:) antibody kappa chain

SCOPe Domain Sequences for d5mvjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mvjb1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

SCOPe Domain Coordinates for d5mvjb1:

Click to download the PDB-style file with coordinates for d5mvjb1.
(The format of our PDB-style files is described here.)

Timeline for d5mvjb1: