SCOPe 2.07: Domain d5ysfa1: 5ysf A:34-414

Lineage for d5ysfa1 (5ysf A:34-414)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Listeria innocua [TaxId:272626] [351713] (4 PDB entries)

8. Domain d5ysfa1: 5ysf A:34-414 [351780]
   Other proteins in same PDB: d5ysfa2, d5ysfb2
   automated match to d2zyma_
   complexed with bgc, mg, mpd

Details for d5ysfa1

PDB Entry: 5ysf, 1.9 Å

PDB Description: crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophoropentaose

PDB Compounds: (A:) Lin1841 protein

SCOPe Domain Sequences for d5ysfa1:

Sequence; same for both SEQRES and ATOM records:

>d5ysfa1 c.94.1.0 (A:34-414) automated matches {Listeria innocua [TaxId: 272626]}
skvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqm
gttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfy
rtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfd
kdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntl
kdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswl
kdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrg
gadvqtqmdtfndqveallkk

Timeline for d5ysfa1:

• d5ysfa1 is new in SCOPe 2.07-stable
  
• d5ysfa1 appears in the current release, SCOPe 2.08