Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [276702] (8 PDB entries) |
Domain d5xcnx_: 5xcn X: [351775] automated match to d4lmaa_ mutant |
PDB Entry: 5xcn (more details), 1.69 Å
SCOPe Domain Sequences for d5xcnx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xcnx_ c.79.1.0 (X:) automated matches {Haemophilus influenzae [TaxId: 71421]} aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgak gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa serylstalfegi
Timeline for d5xcnx_: