Lineage for d5xcnx_ (5xcn X:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515302Species Haemophilus influenzae [TaxId:71421] [276702] (8 PDB entries)
  8. 2515303Domain d5xcnx_: 5xcn X: [351775]
    automated match to d4lmaa_
    mutant

Details for d5xcnx_

PDB Entry: 5xcn (more details), 1.69 Å

PDB Description: crystal structure of m120a mutant of o-acetyl-l-serine sulfahydrylase from haemophilus influenzae
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d5xcnx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xcnx_ c.79.1.0 (X:) automated matches {Haemophilus influenzae [TaxId: 71421]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgak
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalfegi

SCOPe Domain Coordinates for d5xcnx_:

Click to download the PDB-style file with coordinates for d5xcnx_.
(The format of our PDB-style files is described here.)

Timeline for d5xcnx_: