Lineage for d1raaa2 (1raa A:151-310)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708619Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 708620Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 708621Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 708622Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 708638Species Escherichia coli [TaxId:562] [53674] (45 PDB entries)
  8. 708732Domain d1raaa2: 1raa A:151-310 [35161]
    Other proteins in same PDB: d1raab1, d1raab2, d1raad1, d1raad2

Details for d1raaa2

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d1raaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raaa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d1raaa2:

Click to download the PDB-style file with coordinates for d1raaa2.
(The format of our PDB-style files is described here.)

Timeline for d1raaa2: