SCOPe 2.07: Domain d5z5fa1: 5z5f A:1-304

Lineage for d5z5fa1 (5z5f A:1-304)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.0: automated matches [227228] (1 protein)
   not a true family

6. Protein automated matches [226971] (7 species)
   not a true protein

7. Species Geobacillus thermoleovorans [TaxId:33941] [351576] (4 PDB entries)

8. Domain d5z5fa1: 5z5f A:1-304 [351583]
   Other proteins in same PDB: d5z5fa2
   automated match to d1yrza2
   complexed with ca, fub

Details for d5z5fa1

PDB Entry: 5z5f, 2.1 Å

PDB Description: crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 in complex with l-arabinose

PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5z5fa1:

Sequence; same for both SEQRES and ATOM records:

>d5z5fa1 b.67.2.0 (A:1-304) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
meysnpvikgfypdpsicrvgsdyylvtssfqyfpgvpifhstnlinwnkigyclirpsq
lmlnnatnrsgifaptlryhegifylittnvtlkknfivmsedlqgewsepiwidgwggi
dpslffdndgkvyitgtndnargeelgiyqaeidlkkgsiigerkliwkgtggsypeaph
lykvngwyylliaeggteyghmvtvarskypfgpfescpfnpilthrstnhplqaighad
ivqyhdgswwavfhgtrpisyppkhhlgretclapikwtddgwpiigyngridikmdagy
lpvk

Timeline for d5z5fa1:

• d5z5fa1 is new in SCOPe 2.07-stable
  
• d5z5fa1 appears in the current release, SCOPe 2.08