Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (25 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [351557] (2 PDB entries) |
Domain d5zn8a_: 5zn8 A: [351559] automated match to d3o94a_ complexed with zn |
PDB Entry: 5zn8 (more details), 2 Å
SCOPe Domain Sequences for d5zn8a_:
Sequence, based on SEQRES records: (download)
>d5zn8a_ c.33.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdaddd fhpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklre rqitelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaq vae
>d5zn8a_ c.33.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshadddf hpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklrer qitelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaqv ae
Timeline for d5zn8a_: