Lineage for d6ck9e_ (6ck9 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368916Domain d6ck9e_: 6ck9 E: [351480]
    Other proteins in same PDB: d6ck9l2
    automated match to d2rhea_
    complexed with bma, man, nag

Details for d6ck9e_

PDB Entry: 6ck9 (more details), 2.71 Å

PDB Description: crystal structure of hiv-1 conc_base0 prefusion env trimer in complex with human antibody fragment 3h109l and 35o22 variants at 3.5 angstrom
PDB Compounds: (E:) 35O22 scFv light chain portion

SCOPe Domain Sequences for d6ck9e_:

Sequence, based on SEQRES records: (download)

>d6ck9e_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgisp
rfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkv

Sequence, based on observed residues (ATOM records): (download)

>d6ck9e_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgisp
rfsgyksywsayltisdettyyccsythnsgcvfgtgtkv

SCOPe Domain Coordinates for d6ck9e_:

Click to download the PDB-style file with coordinates for d6ck9e_.
(The format of our PDB-style files is described here.)

Timeline for d6ck9e_: