SCOPe 2.07: Domain d6c2ya3: 6c2y A:551-668

Lineage for d6c2ya3 (6c2y A:551-668)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d6c2ya3: 6c2y A:551-668 [351422]
   Other proteins in same PDB: d6c2ya1, d6c2ya2, d6c2yb_, d6c2yg_
   automated match to d3krwa3
   complexed with ejs

Details for d6c2ya3

PDB Entry: 6c2y, 2.74 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257142

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d6c2ya3:

Sequence; same for both SEQRES and ATOM records:

>d6c2ya3 b.55.1.0 (A:551-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsve
etqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Timeline for d6c2ya3:

• d6c2ya3 is new in SCOPe 2.07-stable
  
• d6c2ya3 appears in the current release, SCOPe 2.08