Lineage for d6ci0b2 (6ci0 B:130-281)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366998Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2366999Protein Cytochrome c oxidase [49544] (4 species)
  7. 2367074Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries)
  8. 3051354Domain d6ci0b2: 6ci0 B:130-281 [351416]
    Other proteins in same PDB: d6ci0a_, d6ci0b1, d6ci0b3, d6ci0c_, d6ci0d1, d6ci0d3
    automated match to d1m56b1
    complexed with ca, cd, cu, dmu, hea, hth, k, mal, mg, trd, trs; mutant

Details for d6ci0b2

PDB Entry: 6ci0 (more details), 2.4 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with e101a (ii) mutation
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6ci0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ci0b2 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOPe Domain Coordinates for d6ci0b2:

Click to download the PDB-style file with coordinates for d6ci0b2.
(The format of our PDB-style files is described here.)

Timeline for d6ci0b2:

  • d6ci0b2 is new in SCOPe 2.07-stable