Lineage for d6ci0c_ (6ci0 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579534Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2579535Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2579536Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2579628Protein automated matches [190134] (4 species)
    not a true protein
  7. 3051341Species Rhodobacter sphaeroides [TaxId:1063] [351403] (1 PDB entry)
  8. 3051343Domain d6ci0c_: 6ci0 C: [351405]
    Other proteins in same PDB: d6ci0b1, d6ci0b2, d6ci0b3, d6ci0d1, d6ci0d2, d6ci0d3
    automated match to d3omaa_
    complexed with ca, cd, cu, dmu, hea, hth, k, mal, mg, trd, trs; mutant

Details for d6ci0c_

PDB Entry: 6ci0 (more details), 2.4 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with e101a (ii) mutation
PDB Compounds: (C:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d6ci0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ci0c_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

SCOPe Domain Coordinates for d6ci0c_:

Click to download the PDB-style file with coordinates for d6ci0c_.
(The format of our PDB-style files is described here.)

Timeline for d6ci0c_:

  • d6ci0c_ is new in SCOPe 2.07-stable