Lineage for d6b0td3 (6b0t D:260-382)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402255Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2402372Family b.42.5.0: automated matches [267627] (1 protein)
    not a true family
  6. 2402373Protein automated matches [267678] (1 species)
    not a true protein
  7. 2402374Species Human (Homo sapiens) [TaxId:9606] [267866] (2 PDB entries)
  8. 2402397Domain d6b0td3: 6b0t D:260-382 [351391]
    automated match to d3llpa3
    complexed with c7v

Details for d6b0td3

PDB Entry: 6b0t (more details), 2.8 Å

PDB Description: structural insights into the induced-fit inhibition of fascin by a small molecule
PDB Compounds: (D:) fascin

SCOPe Domain Sequences for d6b0td3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b0td3 b.42.5.0 (D:260-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
caqvvlqaanernvstrqgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtlta
tggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmk
lin

SCOPe Domain Coordinates for d6b0td3:

Click to download the PDB-style file with coordinates for d6b0td3.
(The format of our PDB-style files is described here.)

Timeline for d6b0td3: