Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries) |
Domain d5xkfc1: 5xkf C:1-245 [351368] Other proteins in same PDB: d5xkfa2, d5xkfb2, d5xkfc2, d5xkfd2, d5xkfe_, d5xkff1, d5xkff2, d5xkff3 automated match to d5fnva1 complexed with 88u, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5xkf (more details), 2.8 Å
SCOPe Domain Sequences for d5xkfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xkfc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5xkfc1: