Lineage for d5vgpb2 (5vgp B:343-447)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362129Domain d5vgpb2: 5vgp B:343-447 [351270]
    automated match to d1hzhh4
    complexed with bma, fuc, gal, man, nag

Details for d5vgpb2

PDB Entry: 5vgp (more details), 2.12 Å

PDB Description: fc fragment of human igg1 antibody, from nist mab
PDB Compounds: (B:) Hepatitis B virus receptor binding protein

SCOPe Domain Sequences for d5vgpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vgpb2 b.1.1.2 (B:343-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d5vgpb2:

Click to download the PDB-style file with coordinates for d5vgpb2.
(The format of our PDB-style files is described here.)

Timeline for d5vgpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vgpb1