SCOPe 2.07: Domain d6fr7a1: 6fr7 A:0-114

Lineage for d6fr7a1 (6fr7 A:0-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6fr7a1: 6fr7 A:0-114 [351206]
   Other proteins in same PDB: d6fr7a2, d6fr7b2
   automated match to d2ak4d1
   complexed with edo, so4

Details for d6fr7a1

PDB Entry: 6fr7, 2.31 Å

PDB Description: ha1.7 human t-cell receptor specific for influenza virus epitope pkyvkqntlklat presented by human leukocyte antigen hla-dr0101

PDB Compounds: (A:) T-cell receptor alpha chain

SCOPe Domain Sequences for d6fr7a1:

Sequence; same for both SEQRES and ATOM records:

>d6fr7a1 b.1.1.0 (A:0-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
ngfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiip

Timeline for d6fr7a1:

• d6fr7a1 is new in SCOPe 2.07-stable
  
• d6fr7a1 appears in the current release, SCOPe 2.08