Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6eh5b2: 6eh5 B:116-244 [351198] Other proteins in same PDB: d6eh5a2 automated match to d3q5ya2 complexed with edo, gol, pg4 |
PDB Entry: 6eh5 (more details), 1.29 Å
SCOPe Domain Sequences for d6eh5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eh5b2 b.1.1.0 (B:116-244) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d6eh5b2: