SCOPe 2.07: Domain d6eh5b2: 6eh5 B:116-244

Lineage for d6eh5b2 (6eh5 B:116-244)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6eh5b2: 6eh5 B:116-244 [351198]
   Other proteins in same PDB: d6eh5a2
   automated match to d3q5ya2
   complexed with edo, gol, pg4

Details for d6eh5b2

PDB Entry: 6eh5, 1.29 Å

PDB Description: 003 human t-cell receptor specific for hiv gag epitope slyntvatl carried by human leukocyte antigen hla-a*0201

PDB Compounds: (B:) Human T Cell Receptor Beta Chain

SCOPe Domain Sequences for d6eh5b2:

Sequence; same for both SEQRES and ATOM records:

>d6eh5b2 b.1.1.0 (B:116-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6eh5b2:

• d6eh5b2 is new in SCOPe 2.07-stable
  
• d6eh5b2 appears in the current release, SCOPe 2.08