SCOPe 2.07: Domain d6furd2: 6fur D:112-240

Lineage for d6furd2 (6fur D:112-240)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6furd2: 6fur D:112-240 [351190]
   Other proteins in same PDB: d6fura2, d6furc2
   automated match to d2nw2b2
   complexed with edo, gol, so4

Details for d6furd2

PDB Entry: 6fur, 1.73 Å

PDB Description: f11 t-cell receptor recognising pkyvkqntlklat peptide presented by hla-dr*0101

PDB Compounds: (D:) Human F11 T-Cell Receptor

SCOPe Domain Sequences for d6furd2:

Sequence; same for both SEQRES and ATOM records:

>d6furd2 b.1.1.0 (D:112-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvsppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6furd2:

• d6furd2 is new in SCOPe 2.07-stable
  
• d6furd2 appears in the current release, SCOPe 2.08