Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein automated matches [191082] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189791] (33 PDB entries) |
Domain d6g9zb_: 6g9z B: [351188] automated match to d5o8ga_ complexed with lmr |
PDB Entry: 6g9z (more details), 1.43 Å
SCOPe Domain Sequences for d6g9zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g9zb_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaed ddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d6g9zb_: