Lineage for d6aneb1 (6ane B:2-263)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509925Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2509960Domain d6aneb1: 6ane B:2-263 [351119]
    Other proteins in same PDB: d6aneb2
    automated match to d5xfya_
    complexed with mg

Details for d6aneb1

PDB Entry: 6ane (more details), 2.02 Å

PDB Description: crystal structure of ideonella sakaiensis pet hydrolase
PDB Compounds: (B:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6aneb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aneb1 c.69.1.0 (B:2-263) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
stfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d6aneb1:

Click to download the PDB-style file with coordinates for d6aneb1.
(The format of our PDB-style files is described here.)

Timeline for d6aneb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6aneb2