Lineage for d5ylsd2 (5yls D:244-431)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566565Domain d5ylsd2: 5yls D:244-431 [351107]
    Other proteins in same PDB: d5ylsa1, d5ylsb1, d5ylsc1, d5ylsd1, d5ylse_, d5ylsf1, d5ylsf2, d5ylsf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, y50

Details for d5ylsd2

PDB Entry: 5yls (more details), 3 Å

PDB Description: crystal structure of t2r-ttl-y50 complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5ylsd2:

Sequence, based on SEQRES records: (download)

>d5ylsd2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5ylsd2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5ylsd2:

Click to download the PDB-style file with coordinates for d5ylsd2.
(The format of our PDB-style files is described here.)

Timeline for d5ylsd2: