SCOPe 2.07: Domain d5vjqf2: 5vjq F:108-212

Lineage for d5vjqf2 (5vjq F:108-212)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d5vjqf2: 5vjq F:108-212 [351066]
Other proteins in same PDB: d5vjqb1, d5vjqd1, d5vjqf1, d5vjqh1, d5vjqi_, d5vjqj_, d5vjqk_, d5vjql_
automated match to d2fd6l2
complexed with cl, gol; mutant

Details for d5vjqf2

PDB Entry: 5vjq (more details), 1.9 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant (i29f, s52t, y53f) and pekin duck egg lysozyme isoform i (del-i)

PDB Compounds: (F:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjqf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjqf2 b.1.1.2 (F:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5vjqf2:

Click to download the PDB-style file with coordinates for d5vjqf2.
(The format of our PDB-style files is described here.)

Timeline for d5vjqf2: