Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Persephonella marina [TaxId:309805] [350833] (1 PDB entry) |
Domain d6ekie_: 6eki E: [351020] automated match to d4coqb_ complexed with zn |
PDB Entry: 6eki (more details), 2.56 Å
SCOPe Domain Sequences for d6ekie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ekie_ b.74.1.0 (E:) automated matches {Persephonella marina [TaxId: 309805]} hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
Timeline for d6ekie_: