Lineage for d6ekie_ (6eki E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2422210Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2422211Protein automated matches [191011] (16 species)
    not a true protein
  7. 2422400Species Persephonella marina [TaxId:309805] [350833] (1 PDB entry)
  8. 2422405Domain d6ekie_: 6eki E: [351020]
    automated match to d4coqb_
    complexed with zn

Details for d6ekie_

PDB Entry: 6eki (more details), 2.56 Å

PDB Description: structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
PDB Compounds: (E:) carbonic anhydrase

SCOPe Domain Sequences for d6ekie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekie_ b.74.1.0 (E:) automated matches {Persephonella marina [TaxId: 309805]}
hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd

SCOPe Domain Coordinates for d6ekie_:

Click to download the PDB-style file with coordinates for d6ekie_.
(The format of our PDB-style files is described here.)

Timeline for d6ekie_: