Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:190304] [333378] (7 PDB entries) |
Domain d5xema1: 5xem A:2-302 [350975] Other proteins in same PDB: d5xema2 automated match to d4aeca_ complexed with 85f, act, ca, peg, pg0, pg5, plp |
PDB Entry: 5xem (more details), 1.84 Å
SCOPe Domain Sequences for d5xema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xema1 c.79.1.0 (A:2-302) automated matches {Fusobacterium nucleatum [TaxId: 190304]} lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgmk aclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsf sgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdil vcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyls n
Timeline for d5xema1: