Lineage for d5xema1 (5xem A:2-302)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515282Species Fusobacterium nucleatum [TaxId:190304] [333378] (7 PDB entries)
  8. 2515283Domain d5xema1: 5xem A:2-302 [350975]
    Other proteins in same PDB: d5xema2
    automated match to d4aeca_
    complexed with 85f, act, ca, peg, pg0, pg5, plp

Details for d5xema1

PDB Entry: 5xem (more details), 1.84 Å

PDB Description: crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum in complex with l-lanthionine-plp schiff base
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d5xema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xema1 c.79.1.0 (A:2-302) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk
dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgmk
aclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsf
sgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdil
vcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyls
n

SCOPe Domain Coordinates for d5xema1:

Click to download the PDB-style file with coordinates for d5xema1.
(The format of our PDB-style files is described here.)

Timeline for d5xema1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xema2
View in 3D
Domains from other chains:
(mouse over for more information)
d5xemb_