SCOPe 2.07: Domain d5vgub_: 5vgu B:

Lineage for d5vgub_ (5vgu B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (7 species)
   not a true protein

7. Species Halothece sp. [TaxId:65093] [350926] (1 PDB entry)

8. Domain d5vgub_: 5vgu B: [350963]
   automated match to d2a10a1

Details for d5vgub_

PDB Entry: 5vgu, 1.81 Å

PDB Description: structure of halothece sp. pcc 7418 ccmk4

PDB Compounds: (B:) Microcompartments protein

SCOPe Domain Sequences for d5vgub_:

Sequence; same for both SEQRES and ATOM records:

>d5vgub_ d.58.56.1 (B:) automated matches {Halothece sp. [TaxId: 65093]}
sldavgsletkgfpgvlaaadamvktgrvtlvgyiragsarftiiirgdvsevktamdag
ihavdkaygaaletwviiprphenvecvlpiaynenverfr

Timeline for d5vgub_:

• d5vgub_ is new in SCOPe 2.07-stable
  
• d5vgub_ appears in the current release, SCOPe 2.08