Class b: All beta proteins [48724] (178 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries) |
Domain d6fmic_: 6fmi C: [350905] Other proteins in same PDB: d6fmia_, d6fmib_, d6fmid_, d6fmie_ automated match to d1lm8v_ complexed with dv2 |
PDB Entry: 6fmi (more details), 2.8 Å
SCOPe Domain Sequences for d6fmic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmic_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerlt
Timeline for d6fmic_: