Lineage for d6cv6g_ (6cv6 G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466085Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2466535Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 2466536Protein automated matches [191250] (6 species)
    not a true protein
  7. 2466622Species Paraburkholderia phymatum [TaxId:391038] [350810] (1 PDB entry)
  8. 2466629Domain d6cv6g_: 6cv6 G: [350867]
    Other proteins in same PDB: d6cv6b2, d6cv6c2, d6cv6e2, d6cv6i2
    automated match to d1uqra_
    complexed with cl, tar, tla

Details for d6cv6g_

PDB Entry: 6cv6 (more details), 2.6 Å

PDB Description: crystal structure of 3-dehydroquinate dehydratase, type ii, from burkholderia phymatum stm815
PDB Compounds: (G:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d6cv6g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cv6g_ c.23.13.0 (G:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
mkkvlmlhginhnmfgkrdpvqygtitlseidnrlqalaaelgvqvesfqtnsegamcer
ihqafeercdavlinagawthysygirdalailtcpvvelhmsnvharepfrhhsvfsev
vvgqicgfgmesyllalraavaqsg

SCOPe Domain Coordinates for d6cv6g_:

Click to download the PDB-style file with coordinates for d6cv6g_.
(The format of our PDB-style files is described here.)

Timeline for d6cv6g_: