Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6fxnr1: 6fxn R:2-107 [350713] Other proteins in same PDB: d6fxna_, d6fxnb_, d6fxnc_, d6fxne2, d6fxng2, d6fxni2, d6fxnj_, d6fxnk_, d6fxnl_, d6fxnn2, d6fxnp2, d6fxnr2 automated match to d4ocrl1 |
PDB Entry: 6fxn (more details), 2.9 Å
SCOPe Domain Sequences for d6fxnr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxnr1 b.1.1.0 (R:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} seltqdpavsvalgqtvrvtcqgdslrsyyaswyqqkpgqapvlviygknnrpsgipdrf sgsssgntasltitgaqaedeadyycssrdssgnhwvfgggteltv
Timeline for d6fxnr1: