Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein automated matches [190340] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187164] (12 PDB entries) |
Domain d6f9ta_: 6f9t A: [350680] automated match to d4c2oa_ complexed with bma, bo3, cl, d0z, edo, fuc, imd, man, nag, peg, pge, zn |
PDB Entry: 6f9t (more details), 1.6 Å
SCOPe Domain Sequences for d6f9ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f9ta_ d.92.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} deaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygtqa rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq litgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns
Timeline for d6f9ta_: