Lineage for d6cn1b_ (6cn1 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2563818Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2563828Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2563960Protein automated matches [190917] (11 species)
    not a true protein
  7. 2564010Species Pseudomonas putida [TaxId:160488] [350171] (1 PDB entry)
  8. 2564012Domain d6cn1b_: 6cn1 B: [350406]
    Other proteins in same PDB: d6cn1a2, d6cn1h2
    automated match to d1nawa_
    complexed with 0v5, cl, epu, mg

Details for d6cn1b_

PDB Entry: 6cn1 (more details), 2.75 Å

PDB Description: 2.75 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from pseudomonas putida in complex with uridine-diphosphate-2(n-acetylglucosaminyl) butyric acid, (2r)-2- (phosphonooxy)propanoic acid and magnesium
PDB Compounds: (B:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d6cn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cn1b_ d.68.2.2 (B:) automated matches {Pseudomonas putida [TaxId: 160488]}
mdkliitggarldgeirisgaknaalpilaatlladgpvtvgnlphlhdittmielfgrm
giepvideklsveidprtiktlvapyelvktmrasilvlgpmvarfgeaevalpggcaig
srpvdlhirgleamgakieveggyikakapegglrgahfffdtvsvtgtenimmaaalak
grsvlqnaarepevvdlanfinamggniqgagtdtitidgverldsanyrvmpdrietgt
ylvaaavtggrvkvkdtdptileavleklkeagadintgedwieldmhgkrpkavnlrta
pypafptdmqaqfislnaiaegtgavietifenrfmhvyemhrmgaqiqvegntaivtgv
kalkgapvmatdlrasaslvlsalvaegdtlidriyhidrgyecieeklqmlgakirrvp
g

SCOPe Domain Coordinates for d6cn1b_:

Click to download the PDB-style file with coordinates for d6cn1b_.
(The format of our PDB-style files is described here.)

Timeline for d6cn1b_: