Lineage for d6cnzd_ (6cnz D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345538Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2345539Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2345602Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2345603Protein automated matches [237402] (7 species)
    not a true protein
  7. 2345611Species Burkholderia thailandensis [TaxId:271848] [237403] (2 PDB entries)
  8. 2345621Domain d6cnzd_: 6cnz D: [350382]
    automated match to d4oj7c_
    complexed with edo, no3

Details for d6cnzd_

PDB Entry: 6cnz (more details), 2.15 Å

PDB Description: crystal structure of chorismate mutase from burkholderia thailandensis
PDB Compounds: (D:) chorismate mutase

SCOPe Domain Sequences for d6cnzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cnzd_ a.130.1.0 (D:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya
rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl
rdapdcpsrlarsianwktltrydsaqkdalgtalshvca

SCOPe Domain Coordinates for d6cnzd_:

Click to download the PDB-style file with coordinates for d6cnzd_.
(The format of our PDB-style files is described here.)

Timeline for d6cnzd_: