Lineage for d6ehhd_ (6ehh D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2577870Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2577995Species Mus musculus [TaxId:10090] [346571] (3 PDB entries)
  8. 2578005Domain d6ehhd_: 6ehh D: [350331]
    automated match to d5ws7a_
    complexed with 2ge, cu, gol, mg, no3, peg; mutant

Details for d6ehhd_

PDB Entry: 6ehh (more details), 2.4 Å

PDB Description: crystal structure of mouse mth1 mutant l116m with inhibitor th588
PDB Compounds: (D:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6ehhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehhd_ d.113.1.1 (D:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Mus musculus [TaxId: 10090]}
tsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvd
tlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadmwpddsy
wfplllqkkkfcghfkfqdqdtilsyslrevdsf

SCOPe Domain Coordinates for d6ehhd_:

Click to download the PDB-style file with coordinates for d6ehhd_.
(The format of our PDB-style files is described here.)

Timeline for d6ehhd_: