SCOPe 2.08: Domain d6ctyc1: 6cty C:1-347

Lineage for d6ctyc1 (6cty C:1-347)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [331414] (1 PDB entry)

8. Domain d6ctyc1: 6cty C:1-347 [350328]
   Other proteins in same PDB: d6ctyc2
   automated match to d4lfyb_
   complexed with mlt, zn

Details for d6ctyc1

PDB Entry: 6cty, 2.41 Å

PDB Description: crystal structure of dihydroorotase pyrc from yersinia pestis in complex with zinc and malate at 2.4 a resolution

PDB Compounds: (C:) dihydroorotase

SCOPe Domain Sequences for d6ctyc1:

Sequence; same for both SEQRES and ATOM records:

>d6ctyc1 c.1.9.0 (C:1-347) automated matches {Yersinia pestis [TaxId: 632]}
mtaqpqtlkirrpddwhihlrddemlstvlpytsevfaraivmpnlaqpittvasaiayr
erilaavpaghkftplmtcyltnsldakelttgfeqgvftaaklypanattnsthgvsdi
paiyplfeqmqkigmpllihgevtdaavdifdrearfidqilepirqkfpelkivfehit
tkdaadyvlagnrflgatvtpqhlmfnrnhmlvggirphlfclpilkrsthqqalraava
sgsdrfflgtdsaphakhrkesscgcagvfnapaalpayasvfeelnalqhleafcalng
prfyglpvnddvvelvrtpflqpeeiplgnesvipflagqtlnwsvk

Timeline for d6ctyc1:

• d6ctyc1 first appeared in SCOPe 2.07